Antibodies

Jump to Filters
View as table Download
Enkephalin (PENK) Rabbit Polyclonal Antibody
TA345157

USD 475.00

5 Days

Rabbit Polyclonal Anti-PENK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
Enkephalin (PENK) Rabbit Polyclonal Antibody
TA379803

USD 220.00

3 Weeks

PENK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1).
Modifications Unmodified