Rabbit Polyclonal Anti-RNF113B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the C terminal of human RNF113B. Synthetic peptide located within the following region: HYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR |
Rabbit polyclonal anti-RNF113B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RNF113B. |
Rabbit Polyclonal Anti-RNF113B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B. Synthetic peptide located within the following region: MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYL |
Rabbit Polyclonal Anti-RNF113B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B. Synthetic peptide located within the following region: HDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQ |
Germany
Japan
United Kingdom
China