RNF113B Rabbit Polyclonal Antibody

CAT#: TA337737

Rabbit Polyclonal Anti-RNF113B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RNF113B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B. Synthetic peptide located within the following region: MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name ring finger protein 113B
Background RNF113B contains 1 RING-type zinc finger and 1 C3H1-type zinc finger and the function remains unknown.
Synonyms bA10G5.1; RNF161; ZNF183L1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.