Antibodies

View as table Download

Rabbit polyclonal antibody to SH3GL1 (SH3-domain GRB2-like 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 152 and 368 of EEN (Uniprot ID#Q99961)

Rabbit polyclonal Anti-SH3GL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

SH3GL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1).
Modifications Unmodified