SH3 containing Grb 2 like 1 protein (SH3GL1) Rabbit Polyclonal Antibody

CAT#: TA342206

Rabbit polyclonal Anti-SH3GL1 Antibody

Product Images

WB Suggested Anti-SH3GL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: SH3 domain containing GRB2 like 1, endophilin A2
• Database Link:
  NP_003016
  Entrez Gene 20405 MouseEntrez Gene 6455 Human
  UniProt ID Q99961
• Background: This gene encodes a member ofThe endophilin family of Src homology 3 domain-containing proteins.The encoded protein is involved in endocytosis and may also play a role inThe cell cycle. Overexpression ofThis gene may play a role in leukemogenesis, andThe encoded protein has been implicated in acute myeloid leukemia as a fusion partner ofThe myeloid-lymphoid leukemia protein. Pseudogenes ofThis gene are located onThe long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Jan 2011]
• Synonyms: CNSA1; EEN; SH3D2B; SH3P8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis