Rabbit Polyclonal Anti-SOX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX6 antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: TYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN |
Rabbit polyclonal anti-SOX6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human SOX6. |
Rabbit Polyclonal Anti-SOX6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX6 Antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN |
Rabbit anti SOX-6 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the Internal sequence (from 80aa-120aa) of human SOX14 protein. This sequence is identical in human, mouse and rat species. |
SOX6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human SOX6 (NP_001139291.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
