SOX6 Rabbit Polyclonal Antibody

CAT#: TA331894

Rabbit Polyclonal Anti-SOX6 Antibody

Product Images

WB Suggested Anti-SOX6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOX6 Antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: SRY-box 6
• Database Link:
  NP_201583
  Entrez Gene 20679 MouseEntrez Gene 55553 Human
  UniProt ID P35712
• Background: SOX6 is a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. SOX6 is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. SOX6 interacts with other family members to cooperatively activate gene expression.Members of the SOX gene family, such as SOX6, encode transcription factors defined by the conserved high mobility group (HMG) DNA-binding domain. Unlike most transcription factors, SOX transcription factors bind to the minor groove of DNA, causing a 70- to 85-degree bend and introducing local conformational changes (Cohen-Barak et al., 2001 [PubMed 11255018]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2696 AL136780.1 1-2696 2697-5158 AC009869.7 10394-12855
• Synonyms: HSSOX6; SOXD
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors