Antibodies

View as table Download

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAP antibody: synthetic peptide directed towards the C terminal of human STRAP. Synthetic peptide located within the following region: ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL

Rabbit Polyclonal Anti-STRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAP antibody: synthetic peptide directed towards the N terminal of human STRAP. Synthetic peptide located within the following region: HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

STRAP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STRAP

STRAP Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human STRAP (NP_009109.3).
Modifications Unmodified