Antibodies

View as table Download

TAF10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TAF10

Rabbit polyclonal TAF10 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TAF10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 121-150 amino acids from the Central region of human TAF10.

Rabbit Polyclonal anti-TAF10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the middle region of human TAF10. Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK

Rabbit Polyclonal anti-TAF10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10. Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Rabbit Polyclonal Anti-TAF10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TAF10

TAF10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TAF10.