Rabbit Polyclonal TIRAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TIRAP antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of mouse TIRAP. |
Rabbit Polyclonal TIRAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TIRAP antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of mouse TIRAP. |
Rabbit Polyclonal TIRAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TIRAP antibody was raised against a peptide corresponding to amino acids near the middle of human TIRAP. |
Rabbit Polyclonal Anti-TIRAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW |
Rabbit Polyclonal Anti-TIRAP Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TIRAP Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human TIRAP (NP_001034750.1). |
Modifications | Unmodified |