WIPI2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WIPI2 |
WIPI2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WIPI2 |
WIPI2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 187-436 of human WIPI2 (NP_057087.2). |
Modifications | Unmodified |
WIPI2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 187-436 of human WIPI2 (NP_057087.2). |
Modifications | Unmodified |
Rabbit Polyclonal WIPI2 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal WIPI2 antibody was raised against a 17 amino acid peptide near the amino terminus of human WIPI2. |
Rabbit Polyclonal Anti-WIPI2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WIPI2 Antibody is: synthetic peptide directed towards the C-terminal region of Human WIPI2. Synthetic peptide located within the following region: AFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLMASTS |
WIPI2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WIPI2 |