Antibodies

View as table Download

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%).

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 17 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Horse (94%); Bat, Pig (88%); Mouse, Rat, Hamster, Rabbit (82%).

WNT11 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%).

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%).

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%).

ENTPD2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Human, Monkey
Conjugation Unconjugated
Immunogen ENTPD2 antibody was raised against synthetic 14 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey (100%); Gorilla, Bovine, Horse (93%); Galago, Elephant, Guinea pig (86%).

Rabbit polyclonal anti-Oct-4 antibody

Applications WB
Reactivities Human, Monkey, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein.

Rabbit polyclonal anti-NEDD4 antibody

Applications WB
Reactivities Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of the Nedd4 protein.

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit Polyclonal Anti-SIAH3 Antibody

Applications WB
Reactivities Human, Rabbit, Dog, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA

Rabbit Polyclonal Anti-GPR116 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR116 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR116. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Hamster, Elephant, Panda, Horse, Rabbit, Pig (94%); Platypus (88%); Bovine, Bat, Ant (81%).

Rabbit Polyclonal Anti-MCHR2 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MCHR2 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human MCHR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Panda, Horse, Platypus (94%); Bat, Elephant, Pig, Xenopus (88%); Bovine (81%).

Rabbit Polyclonal Anti-NR5A1 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse, Rat, Hamster, Elephant, Dog, Horse, Pig (94%); Monkey, Sheep, Panda, Bovine, Rabbit (88%); Opossum, Platypus (81%).

Rabbit Polyclonal Anti-NR5A1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig (94%); Mouse, Rat, Hamster (88%); Turkey, Chicken, Platypus, Xenopus (82%).

Rabbit Polyclonal Anti-CCR9 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CCR9 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CCR9. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Sheep, Bovine, Bat, Pig (100%); Monkey, Ferret, Panda, Dog, Horse, Opossum (94%); Elephant (88%).

Rabbit Polyclonal Anti-GNRHR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GnRH receptor / GNRHR antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human GNRHR. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Dog, Elephant, Panda (95%); Marmoset, Bovine, Horse, Pig (90%); Mouse, Rat, Sheep, Bat, Rabbit, Opossum (85%); Hamster, Guinea pig (80%).

Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%).

Rabbit Polyclonal Anti-BAI2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen BAI2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human BAI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Orangutan, Monkey, Horse (95%); Hamster, Elephant, Panda, Pig (89%); Gibbon, Mouse, Rat, Dog (84%).

Rabbit Polyclonal Anti-CELSR3 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CELSR3 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CELSR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Bovine, Panda (100%); Monkey, Mouse, Rat, Bat, Hamster, Elephant, Horse (95%); Rabbit (90%).

Rabbit Polyclonal Anti-GPRC5B Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RAIG2 / GPRC5B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPRC5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bovine, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Xenopus, Pufferfish, Zebrafish, Stickleback (94%).

Rabbit Polyclonal Anti-MC3R Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MC3R / MC3 Receptor antibody was raised against synthetic 18 amino acid peptide from C-Terminus of human MC3 Receptor. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (94%); Bat, Rabbit, Platypus (89%); Opossum, Turkey, Chicken, Xenopus, Trout (83%).

Rabbit Polyclonal Anti-TAOK1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TAOK1 / TAO1 antibody was raised against synthetic 15 amino acid peptide from internal region of human TAOK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus (93%).

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Horse, Rabbit, Guinea pig, Platypus (94%); Dog, Bat (88%); Rat, Panda (81%).

Rabbit Polyclonal Anti-NR4A1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR4A1 / NUR77 antibody was raised against synthetic 15 amino acid peptide from N-terminal to DNA binding domain of human NUR77. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster (100%); Marmoset, Elephant, Panda, Bovine, Dog, Horse (93%); Bat, Rabbit (87%).

Rabbit Polyclonal Anti-CERK Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%).

Rabbit Polyclonal Anti-WNT5B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT5B antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset (100%); Gorilla, Elephant, Panda, Dog, Horse, Rabbit, Pig, Opossum (93%); Mouse, Hamster, Bovine (86%).

Rabbit Polyclonal Anti-DDR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NEP / DDR1 antibody was raised against synthetic 16 amino acid peptide from internal region of human DDR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Pig (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse (94%); Opossum (88%); Rabbit (81%).

Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%).

Rabbit Polyclonal Anti-KDR Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen KDR / VEGFR2 antibody was raised against synthetic 15 amino acid peptide from internal region of human VEGFR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Bat, Hamster, Panda, Horse (93%); Mouse, Rat, Pig, Platypus (87%); Elephant, Opossum (80%).

Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%).

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%).

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Horse (93%); Hamster, Elephant, Pig (87%); Mouse, Rat, Panda, Dog, Bat, Rabbit, Lizard (80%).

Rabbit Polyclonal Anti-STX1A Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%).

Rabbit Polyclonal Anti-MBOAT4 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen FKSG89 / MBOAT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human MBOAT4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey (100%); Orangutan, Marmoset, Horse (93%); Guinea pig (86%).

Rabbit Polyclonal Anti-ERP44 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ERP44 antibody was raised against synthetic 19 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Dog, Bovine, Hamster, Panda, Rabbit, Horse, Opossum, Turkey, Chicken, Platypus (95%); Mouse, Pig, Lizard (89%); Elephant (84%).

Rabbit Polyclonal Anti-PROM2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Prominin 2 / PROM2 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human PROM2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Bovine, Horse (94%); Gibbon, Bat, Rabbit (88%); Hamster, Elephant (81%).

Rabbit polyclonal anti Thymosin b4 (hu, bo, horse, rt); purified rabbit IgG

Applications ELISA
Reactivities Human, Bovine, Horse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe- Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu- Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH coupled to a carrier protein.

MMP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Horse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1