Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Anti-HSPA1L Antibody
| Applications | WB |
| Reactivities | Human, Lamprey, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Germany
Japan
United Kingdom
China
