Antibodies

Jump to Filters
View as table Download
PYCR2 (Center) Rabbit Polyclonal Antibody
AP53529PU-N

USD 450.00

2 Weeks

PYCR2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 96-124 amino acids from the Central region of Human PYCR2
PYCR2 Rabbit Polyclonal Antibody
TA334474

USD 375.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
PYCR2 Rabbit Polyclonal Antibody
TA334475

USD 375.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2. Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS