PYCR2 Rabbit Polyclonal Antibody

CAT#: TA334474

Rabbit Polyclonal Anti-PYCR2 Antibody

Product Images

Lanes: 1. 10 ug human fibroblast lysate; 2. 10 ug PYCR1 KO human fibroblast lysate; Primary Antibody Dilution: 1: 300; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Gene Name: PYCR2; Submitted by: Anonymous;

• 

  WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

• 

  PYCR2 antibody - middle region validated by WB using 293T cells lysate at 1 ug/ml.

• 

  Sample Type: 1. WT human fibroblast 2. PYCR1 KO human fibroblast Primary Antibody Dilution: 1: 250; Secondary Antibody: Anti-rabbit AlexaFluor 488; Secondary Antibody: ilution: 1: 1000; Color/Signal Descriptions: PYCR2: Green DAPI: Blue; Gene Name: PYCR2

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: pyrroline-5-carboxylate reductase family member 2
• Database Link:
  NP_037460
  Entrez Gene 29920 Human
  UniProt ID Q96C36
• Background: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
• Synonyms: HLD10; P5CR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Arginine and proline metabolism, Metabolic pathways