Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 51 results

Page 1 of 2

(reset)

PYCR2 (Center) Rabbit Polyclonal Antibody

AP53529PU-N

USD 450.00

2 Weeks

PYCR2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 96-124 amino acids from the Central region of Human PYCR2

1 / 2

2 / 2

Previous Next

PYCR2 Rabbit Polyclonal Antibody

TA334474

USD 375.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Rabbit Polyclonal Antibody

TA334475

USD 375.00

5 Days

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2. Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5B7]

CF501876

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4A10]

CF501877

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

CF501897

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2F11]

CF501898

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF501899

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A12]

CF501900

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

CF501901

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4B7]

CF501996

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

CF502144

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Rabbit Polyclonal Antibody

TA366491

USD 380.00

4 Weeks

PYCR2 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PYCR2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Rabbit Polyclonal Antibody

TA370838

USD 380.00

4 Weeks

PYCR2 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human PYCR2

PYCR2 Rabbit Polyclonal Antibody

TA380587

USD 220.00

3 Weeks

PYCR2 Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 271-320 of human PYCR2 (NP_037460.2).
Modifications	Unmodified

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5B7]

TA501876

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B7]

TA501876AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), Biotinylated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B7]

TA501876BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), HRP conjugated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5B7]

TA501876S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4A10]

TA501877

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A10]

TA501877AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A10]

TA501877BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4A10]

TA501877S

USD 159.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

TA501897

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B11]

TA501897AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B11]

TA501897BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

TA501897S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2F11]

TA501898

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F11]

TA501898AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F11]

TA501898BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2F11]

TA501898S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

TA501899

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

TA501899AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]

TA501899BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A5]

TA501899S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A12]

TA501900

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A12]

TA501900AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A12]

TA501900BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI2A12]

TA501900S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA501901

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]

TA501901AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D1]

TA501901BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA501901S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4B7]

TA501996

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B7]

TA501996AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B7]

TA501996BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI4B7]

TA501996S

USD 159.00

2 Days

PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PYCR2 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA502144

USD 379.00

In Stock

PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]

TA502144AM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PYCR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]

TA502144BM

USD 420.00

4 Weeks

PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 50 of 51 results

Page 1 of 2