Antibodies

Jump to Filters
View as table Download
CACNA2D1 (N-term) Rabbit Polyclonal Antibody
AP17917PU-N

USD 450.00

2 Weeks

CACNA2D1 (N-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CACNA2D1
CACNA2D1 Rabbit Polyclonal Antibody
TA338373

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI