CACNA2D1 Rabbit Polyclonal Antibody

CAT#: TA338373

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Product Images

WB Suggested Anti-CACNA2D1 Antibody Titration: 0.12 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: CACNA2D1; Sample Tissue: Fetal Muscle; Lane A: Primary Antibody; Lane B:Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1 ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane/Lane; Gel Concentratio

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 120 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit alpha2delta 1
• Database Link:
  NP_000713
  Entrez Gene 781 Human
  UniProt ID P54289
• Background: This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
• Synonyms: CACNA2; CACNL2A; CCHL2A; LINC01112; lncRNA-N3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway