Antibodies

View as table Download

Rabbit polyclonal RASGRP2 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RASGRP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-34 amino acids from the N-terminal region of human RASGRP2.

Rabbit Polyclonal Anti-RASGRP2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASGRP2 antibody: synthetic peptide directed towards the N terminal of human RASGRP2. Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS