RASGRP2 Rabbit Polyclonal Antibody

CAT#: TA344188

Rabbit Polyclonal Anti-RASGRP2 Antibody - N-terminal region

Product Images

WB Suggested Anti-RASGRP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RASGRP2 antibody: synthetic peptide directed towards the N terminal of human RASGRP2. Synthetic peptide located within the following region: LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: RAS guanyl releasing protein 2
• Database Link:
  NP_722541
  Entrez Gene 10235 Human
  UniProt ID Q7LDG7
• Background: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act
• Synonyms: CALDAG-GEFI; CDC25L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Pathways: Chemokine signaling pathway, MAPK signaling pathway