Antibodies

Jump to Filters
View as table Download
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA342728

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Cryptochrome I (CRY1) (551-555) Rabbit Polyclonal Antibody
AP26054PU-S

USD 230.00

2 Weeks

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.
Cryptochrome I (CRY1) (551-555) Rabbit Polyclonal Antibody
AP26054PU-N

USD 300.00

2 Weeks

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA313696

USD 345.00

4 Weeks

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.