Antibodies

View as table Download

Rabbit polyclonal Anti-RAB5B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Rabbit Polyclonal Antibody against HSPA1A (Y41)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B.

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS