Antibodies

Jump to Filters
View as table Download
Pancreatic Lipase (PNLIP) Rabbit Polyclonal Antibody
TA308036

USD 415.00

5 Days

Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233)
Pancreatic Lipase (PNLIP) Rabbit Polyclonal Antibody
TA334301

USD 310.00

5 Days

Rabbit Polyclonal Anti-PNLIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
Pancreatic Lipase (PNLIP) Rabbit Polyclonal Antibody
TA334302

USD 310.00

5 Days

Rabbit Polyclonal Anti-PNLIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV
Pancreatic Lipase (PNLIP) (C-term) Rabbit Polyclonal Antibody
AP53366PU-N

USD 450.00

2 Weeks

Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP
Pancreatic Lipase (PNLIP) Rabbit Polyclonal Antibody
TA350265

USD 345.00

In Stock

Rabbit Polyclonal Anti-PNLIP Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PNLIP