Antibodies

View as table Download

BCL2A1 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1.

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1.

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Anti-BCL2A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1