Rabbit polyclonal COMT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COMT. |
Rabbit polyclonal COMT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COMT. |
Rabbit Polyclonal Anti-COMT Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Rabbit (93%); Horse (87%); Mouse, Rat, Hamster, Bat, Pig (80%). |
Rabbit Polyclonal Anti-COMT Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from N-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Marmoset (89%); Hamster (84%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Pig (100%); Hamster, Elephant, Panda, Rabbit, Horse (93%); Dog, Turkey, Chicken, Xenopus (87%). |
Rabbit Polyclonal Anti-COMT Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Gibbon, Rabbit (95%); Monkey, Marmoset, Horse (89%); Mouse, Rat, Hamster (84%). |
Rabbit Polyclonal Anti-COMT Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | COMT antibody was raised against synthetic 19 amino acid peptide from C-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%). |