Antibodies

Jump to Filters
View as table Download
POMT1 (C-term) Rabbit Polyclonal Antibody
AP53389PU-N

USD 450.00

2 Weeks

POMT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 706-735 amino acids from the C-terminal region of Human POMT1
POMGNT1 Rabbit Polyclonal Antibody
TA308113

USD 415.00

5 Days

Rabbit polyclonal antibody to POMGNT1 (protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase)

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 98 and 373 of POMGNT1 (Uniprot ID#Q8WZA1)
POMT1 Rabbit Polyclonal Antibody
TA335942

USD 375.00

5 Days

Rabbit Polyclonal Anti-POMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POMT1 Antibody: synthetic peptide directed towards the middle region of human POMT1. Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL
POMT2 Rabbit Polyclonal Antibody
TA341917

USD 375.00

5 Days

Rabbit Polyclonal Anti-POMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC
POMT2 Rabbit Polyclonal Antibody
TA341918

USD 375.00

5 Days

Rabbit Polyclonal Anti-POMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
POMT1 Rabbit Polyclonal Antibody
TA351547

USD 345.00

In Stock

Rabbit Polyclonal Anti-POMT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human POMT1