POMT2 Rabbit Polyclonal Antibody

CAT#: TA341918

Rabbit Polyclonal Anti-POMT2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "POMT2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name protein O-mannosyltransferase 2
Background The protein encoded byThis gene is an O-mannosyltransferase that requires interaction withThe product ofThe POMT1 gene for enzymatic function.The encoded protein is found inThe membrane ofThe endoplasmic reticulum. Defects inThis gene are a cause of Walker-Warburg syndrome (WWS). [provided by RefSeq, Oct 2008]
Synonyms LGMD2N; MDDGA2; MDDGB2; MDDGC2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways O-Mannosyl glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.