Rabbit polyclonal anti-GPR37 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR37. |
Rabbit polyclonal anti-GPR37 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR37. |
Rabbit polyclonal Pael-R (GPR37) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Pael-R (GPR37) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-126 amino acids from the N-terminal region of human Pael-R (GPR37). |
Rabbit Polyclonal Anti-GPR37 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY |
Rabbit Polyclonal Anti-GPR37 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PAEL Receptor / GPR37 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GPR37. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (95%); Marmoset (90%); Rabbit (85%); Panda (80%). |
Rabbit Polyclonal Anti-GPR37 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | PAEL Receptor / GPR37 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GPR37. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Rabbit (88%); Gibbon, Bovine (81%). |