Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the middle region of human EGLN2. Synthetic peptide located within the following region: AVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIF |
EGLN2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human EGLN2 |
EGLN2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 95-123 amino acids from the N-terminal region of human EGLN2 |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGLN2 Antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL |
Germany
Japan
United Kingdom
China