Antibodies

Jump to Filters
View as table Download
AICDA Rabbit Polyclonal Antibody
TA306117

USD 430.00

In Stock

Rabbit Polyclonal AID Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen AID antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human AID.
AICDA Rabbit Polyclonal Antibody
TA351959

USD 345.00

In Stock

Rabbit Polyclonal Anti-AICDA Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AICDA
AICDA Rabbit Polyclonal Antibody
TA358391

USD 360.00

5 Days

AICDA Antibody N-terminal region

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT