Rabbit Polyclonal AID Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | AID antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human AID. |
Rabbit Polyclonal AID Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | AID antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human AID. |
Rabbit Polyclonal Anti-AICDA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AICDA |
AICDA Antibody N-terminal region
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |