AICDA Rabbit Polyclonal Antibody

CAT#: TA358391

AICDA Antibody N-terminal region

Product Images

Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody (TA358391)

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
  Homology: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 24 kDa
• Gene Name: activation-induced cytidine deaminase
• Database Link:
  NP_065712
  Entrez Gene 57379 Human
  UniProt ID Q9GZX7
• Background: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).
• Synonyms: AID; ARP2; CDA2; HIGM2

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Primary immunodeficiency