Antibodies

Jump to Filters
View as table Download
RPL17 (C-term) Rabbit Polyclonal Antibody
AP53709PU-N

USD 450.00

2 Weeks

RPL17 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 155~184 amino acids from the C-terminal region of human RPL17
RPL17 Rabbit Polyclonal Antibody
TA314461

USD 345.00

4 Weeks

Rabbit polyclonal anti-RPL17 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL17.
RPL17 Rabbit Polyclonal Antibody
TA335160

USD 375.00

5 Days

Rabbit polyclonal Anti-Rpl17 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK
RPL17 Rabbit Polyclonal Antibody
TA335161

USD 375.00

5 Days

Rabbit polyclonal Anti-Rpl17 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rpl17 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rpl17. Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS