RPL17 Rabbit Polyclonal Antibody

CAT#: TA335160

Rabbit polyclonal Anti-Rpl17 Antibody

Product Images

WB Suggested Anti-Rpl17 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rpl17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: ribosomal protein L17
• Database Link:
  NP_000976
  Entrez Gene 319195 Mouse
  UniProt ID P18621
• Background: The function of this protein remains unknown.
• Synonyms: L17; PD-1; RPL23
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Ribosome