Antibodies

Jump to Filters
View as table Download
INDOL1 (IDO2) (C-term) Rabbit Polyclonal Antibody
AP52135PU-N

USD 450.00

2 Weeks

INDOL1 (IDO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 267-295 amino acids from the C-terminal region of Human IDO2 / INDOL1
INDOL1 (IDO2) Rabbit Polyclonal Antibody
TA337716

USD 375.00

5 Days

Rabbit Polyclonal Anti-IDO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IDO2. Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH