INDOL1 (IDO2) Rabbit Polyclonal Antibody

CAT#: TA337716

Rabbit Polyclonal Anti-IDO2 Antibody

Product Images

WB Suggested Anti-IDO2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IDO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IDO2. Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: indoleamine 2,3-dioxygenase 2
• Database Link:
  NP_919270
  Entrez Gene 169355 Human
  UniProt ID Q6ZQW0
• Background: Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
• Synonyms: INDOL1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Horse: 92%; Pig: 91%; Mouse: 83%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Metabolic pathways, Tryptophan metabolism