Antibodies

View as table Download

Rabbit Polyclonal antibody to MAPK4 (mitogen-activated protein kinase 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 326 of MAPK4 (Uniprot ID#P31152)

MAPK4 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of Human MAPK4.

MAPK4 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide at the C-term of human MAPK4.

Rabbit polyclonal Anti-MAPK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4. Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

MAPK4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAPK4

MAPK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 348-587 of human MAPK4 (NP_002738.2).
Modifications Unmodified