Antibodies

Jump to Filters
View as table Download
KCNQ4 Rabbit Polyclonal Antibody
TA338541

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNQ4 Antibody

Applications WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ