KCNQ4 Rabbit Polyclonal Antibody

CAT#: TA338541

Rabbit Polyclonal Anti-KCNQ4 Antibody

Product Images

WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

• 

  Lanes: ; 100 ug CHO cell lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Goat anti-rabbit HRP; Secondary Antibody Dilution: ; 1:25000; Gene Name: ; KCNQ4; Submitted by: ; Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Hamster, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: potassium voltage-gated channel subfamily Q member 4
• Database Link:
  NP_004691
  Entrez Gene 9132 Human
  UniProt ID P56696
• Background: The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: DFNA2; DFNA2A; KV7.4
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane