Antibodies

Jump to Filters
View as table Download
CCNL2 Rabbit Polyclonal Antibody
TA339761

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNL2 antibody: synthetic peptide directed towards the N terminal of human CCNL2. Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR
CCNL2 Rabbit Polyclonal Antibody
TA374390

USD 220.00

3 Weeks

Cyclin L2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-150 of human Cyclin L2 (NP_001307082.1).
Modifications Unmodified