Antibodies

View as table Download

EBF2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EBF2

Rabbit Polyclonal Anti-EBF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EBF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human EBF2. Synthetic peptide located within the following region: DIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNN

Rabbit Polyclonal Anti-EBF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF2 antibody: synthetic peptide directed towards the middle region of human EBF2. Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

EBF2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EBF2

EBF2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EBF2