Rabbit Polyclonal Anti-EIF5A2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF5A2 antibody: synthetic peptide directed towards the N terminal of human EIF5A2. Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK |
Rabbit Polyclonal eIF5A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide representing the C-terminus of the Human EIF5 A2 protein. |
EIF5A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human EIF5A2 |
EIF5A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human EIF5A2 (NP_065123.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
