EIF5A2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human eukaryotic translation initiation factor 5A2 (EIF5A2)
USD 823.00
Transient overexpression lysate of eukaryotic translation initiation factor 5A2 (EIF5A2)
USD 396.00
Other products for "EIF5A2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EIF5A2 antibody: synthetic peptide directed towards the N terminal of human EIF5A2. Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 17 kDa |
Gene Name | eukaryotic translation initiation factor 5A2 |
Database Link | |
Background | EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.EIF5A2 is involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. EIF5A2 functions as a regulator of apoptosis.EIF5A2 mediates effects of polyamines on neuronal process extension and survival.EIF5A2 may play an important role in brain development and function, and in skeletal muscle stem cell differentiation. |
Synonyms | EIF-5A2; eIF5AII |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.