EIF5A2 (NM_020390) Human Recombinant Protein
CAT#: TP306249
Recombinant protein of human eukaryotic translation initiation factor 5A2 (EIF5A2)
View other "EIF5A2" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206249 protein sequence
Red=Cloning site Green=Tags(s) MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA MSEEYAVAIKPCK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065123 |
Locus ID | 56648 |
UniProt ID | Q9GZV4 |
Cytogenetics | 3q26.2 |
Refseq Size | 5537 |
Refseq ORF | 459 |
Synonyms | EIF-5A2; eIF5AII |
Summary | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412495 | EIF5A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412495 | Transient overexpression lysate of eukaryotic translation initiation factor 5A2 (EIF5A2) |
USD 396.00 |
|
PH306249 | EIF5A2 MS Standard C13 and N15-labeled recombinant protein (NP_065123) |
USD 2,055.00 |
|
TP721029 | Purified recombinant protein of Human eukaryotic translation initiation factor 5A2 (EIF5A2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review