EIF5A2 (NM_020390) Human Mass Spec Standard

CAT#: PH306249

EIF5A2 MS Standard C13 and N15-labeled recombinant protein (NP_065123)

Product Images

Coomassie blue staining of purified EIF5A2 protein (Cat# TP306249). The protein was produced from HEK293T cells transfected with EIF5A2 cDNA clone (Cat# RC206249) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206249
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206249 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE
  DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA
  MSEEYAVAIKPCK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065123
• RefSeq Size: 5537
• RefSeq ORF: 459
• Synonyms: EIF-5A2; eIF5AII
• Locus ID: 56648
• UniProt ID: Q9GZV4
• Cytogenetics: 3q26.2
• Summary: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. [UniProtKB/Swiss-Prot Function]