Antibodies

View as table Download

Rabbit Polyclonal anti-FGD1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT

Rabbit Polyclonal Anti-FGD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the N terminal of human FGD1. Synthetic peptide located within the following region: HGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSA

FGD1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2).
Modifications Unmodified