Antibodies

Jump to Filters
View as table Download
KCNK6 Rabbit Polyclonal Antibody
TA341716

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
KCNK6 Rabbit Polyclonal Antibody
TA377732

USD 220.00

3 Weeks

KCNK6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1).
Modifications Unmodified