KCNK6 Rabbit Polyclonal Antibody

CAT#: TA341716

Rabbit Polyclonal Anti-KCNK6 Antibody

Product Images

WB Suggested Anti-KCNK6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: potassium two pore domain channel subfamily K member 6
• Database Link:
  NP_004814
  Entrez Gene 9424 Human
  UniProt ID Q9Y257
• Background: This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]
• Synonyms: K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane