KCNK6 Rabbit Polyclonal Antibody

CAT#: TA341716

Rabbit Polyclonal Anti-KCNK6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KCNK6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name potassium two pore domain channel subfamily K member 6
Background This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]
Synonyms K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.