Antibodies

View as table Download

Rabbit Polyclonal Anti-K2P6.1

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus.

Rabbit Polyclonal Anti-KCNK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

KCNK6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1).
Modifications Unmodified