Rabbit Polyclonal Anti-MELK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK |
MELK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human MELK |
MELK Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China