Rabbit polyclonal anti-NFIL3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFIL3. |
Rabbit polyclonal anti-NFIL3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFIL3. |
Rabbit Polyclonal anti-NFIL3 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV |
Rabbit Polyclonal Anti-NFIL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the N terminal of human NFIL3. Synthetic peptide located within the following region: MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEDVLLSEG |
NFIL3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 133-462 of human NFIL3 (NP_005375.2). |
Modifications | Unmodified |