Antibodies

Jump to Filters
View as table Download
NFIL3 Rabbit Polyclonal Antibody
TA312224

USD 345.00

In Stock

Rabbit polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NFIL3.
NFIL3 Rabbit Polyclonal Antibody
TA329213

USD 375.00

5 Days

Rabbit Polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
NFIL3 Rabbit Polyclonal Antibody
TA343536

USD 310.00

5 Days

Rabbit Polyclonal Anti-NFIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the N terminal of human NFIL3. Synthetic peptide located within the following region: MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEDVLLSEG
NFIL3 Rabbit Polyclonal Antibody
TA379086

USD 220.00

3 Weeks

NFIL3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 133-462 of human NFIL3 (NP_005375.2).
Modifications Unmodified